PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Ctg13084213g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 105aa    MW: 11695.5 Da    PI: 10.4264
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Ctg13084213g00002.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.59.5e-304595151
                                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                 krien+snrqvt+skRrngi+KKA+E+ vLCda+v++iif+++gk++ey+s
  Peinf101Ctg13084213g00002.1 45 KRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIFGNSGKMHEYCS 95
                                 79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.2963797IPR002100Transcription factor, MADS-box
SMARTSM004326.3E-403796IPR002100Transcription factor, MADS-box
CDDcd002651.08E-363898No hitNo description
SuperFamilySSF554551.57E-3038100IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003993IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-293959IPR002100Transcription factor, MADS-box
PfamPF003192.4E-234693IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-295974IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-297495IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
TLSISSTSSS YTIHQIKFPY SPLSKPVTSK RSEILGMGRG KIEIKRIENS SNRQVTYSKR  60
RNGIIKKAKE ITVLCDAKVS LIIFGNSGKM HEYCSPSTTL PDMLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-173897160Myocyte-specific enhancer factor 2A
3mu6_C2e-173897160Myocyte-specific enhancer factor 2A
3mu6_B2e-173897160Myocyte-specific enhancer factor 2A
3mu6_A2e-173897160Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX714171e-136X71417.1 P.hybrida fbp3 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803901.11e-42PREDICTED: floral homeotic protein PMADS 2
RefseqXP_009608638.11e-42PREDICTED: floral homeotic protein PMADS 2
RefseqXP_016492047.11e-42PREDICTED: floral homeotic protein PMADS 2
RefseqXP_016483128.11e-42PREDICTED: floral homeotic protein PMADS 2-like
SwissprotQ074745e-46MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLQ408834e-44Q40883_PETHY; FBP3
STRINGSolyc06g059970.2.12e-38(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46802139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.17e-34MIKC_MADS family protein